Use the following button if you want to resubmit the job with
altered input or parameterization:
Input and runtime details for job 9176855 (precomputed example)
Original Protein Sequence
![]() | MSFCSFFGGEVFQNHFEPGVYVCAKCSYELFSSHSKYAHSSPWPAFTETIHPDSVTKCPEKNRPEALKVSCGKCGNGLGHEFLNDGPKRGQSRFCIFSSSLKFVPKGKEAAASQGH |
SECIS Design Constraints
Similarity Scoring
![]() | BLOSUM62 | ||
![]() | -10 | ||
![]() | -5 |
RNAinverse (local search)
![]() | Full Local Search | ||
![]() | mfe -> pf | ||
![]() | 0.7 | ||
![]() | Start Similarity | ||
![]() | all equal |
Job ID 9176855 (server version 4.0.0)
![]() | Job Submitted & Queued | @ Thu Jun 18 18:25:52 CEST 2015 | |
![]() | SECISDesign Started | @ Thu Jun 18 18:26:07 CEST 2015 | |
![]() | SECISDesign Finished & Post-Processing | @ Thu Jun 18 18:26:36 CEST 2015 | |
![]() | Job Completed | @ Thu Jun 18 18:26:37 CEST 2015 |
DIRECT ACCESS: https://rna2.informatik.uni-freiburg.de/RetrieveResults.jsp?jobID=9176855&toolName=SECISDesign ( 30 days expiry )
Description of the job
Custom SECIS in MsrB
Insert a custom SECIS (which is FdhF-std (optional)) to mammalian methionine sulfoxide reductase B (MsrB). See help page for an explanation of the output.
Output
mRNA Sequence with Structure and its Probability for the SECIS-Element region after UGA stop codon
Wanted Structure: | [,[[[[[{[[/((.((((....))))))\]]}]]]]]].... NNNNNNNNNNNSSUWSCAGGUCUGSWSSNNNNNNNNNNNNNN | Prob.: |
mRNA-Sequence without optimizing the stability of the structure: | AUUUUCUCUUCGCUACCAGGUCUGGUGCCAAAAGGAAAAGAA ..(((((.((.((.((((....)))))).)).)))))..... | (0.04) (0.19) |
mRNA-Sequence after optimizing the stability of the structure: | AAGUUCUCUUCGCUAGCAGGUCUGCUGCCAAAAGGACAAGAA | (0.58) |
Amino Acid Sequence after selenocystein insertion position
Original Sequence (starting at pos. 96): | I F S S S L K F V P K G K E |
Without optimizing the stability of the mRNA-structure: | I F S S L P G L V P K G K E |
After optimizing the stability of the mRNA-structure: | K F S S L A G L L P K G Q E |
Job resubmission
usability assessment
When using SECISDesign please cite :
- Anke Busch, Sebastian Will, and Rolf Backofen
SECISDesign - A Server to Design SECIS-Elements within the Coding Sequence
Bioinformatics, 2005, 21(15), 3312-3. - Martin Raden, Syed M Ali, Omer S Alkhnbashi, Anke Busch, Fabrizio Costa, Jason A Davis, Florian Eggenhofer, Rick Gelhausen, Jens Georg, Steffen Heyne, Michael Hiller, Kousik Kundu, Robert Kleinkauf, Steffen C Lott, Mostafa M Mohamed, Alexander Mattheis, Milad Miladi, Andreas S Richter, Sebastian Will, Joachim Wolff, Patrick R Wright, and Rolf Backofen
Freiburg RNA tools: a central online resource for RNA-focused research and teaching
Nucleic Acids Research, 46(W1), W25-W29, 2018.
Results are computed with SECISDesign version 1.0 (2009-10-13) using Turner99 energies